Overview

  • Product name

    Anti-POMK antibody
  • Description

    Rabbit polyclonal to POMK
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human POMK aa 72-121 (N terminal).
    Sequence:

    LSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFLH


    Database link: NP_115613

  • Positive control

    • 721_B cell lysate
  • General notes

    Previously labelled as SGK196. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.

Target

  • Function

    Protein O-mannose kinase that specifically mediates phosphorylation at the 6-position of an O-mannose of the trisaccharide (N-acetylgalactosamine (GalNAc)-beta-1,3-N-acetylglucosamine (GlcNAc)-beta-1,4-mannose) to generate phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-1,3-N-acetylglucosamine-beta-1,4-(phosphate-6-)mannose). Phosphorylated O-mannosyl trisaccharide is a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Only shows kinase activity when the GalNAc-beta-3-GlcNAc-beta-terminus is linked to the 4-position of O-mannose, suggesting that this disaccharide serves as the substrate recognition motif.
  • Involvement in disease

    Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A12
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ23356 antibody
    • MDDGA12 antibody
    • POMK antibody
    • Probable inactive protein kinase-like protein SgK196 antibody
    • Protein kinase like protein SgK196 antibody
    • Protein kinase-like protein SgK196 antibody
    • Protein O-mannose kinase antibody
    • SG196_HUMAN antibody
    • SGK196 antibody
    • Sugen kinase 196 antibody
    see all

Images

  • Anti-POMK antibody (ab81537) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 40 kDa
    Observed band size: 35 kDa
    why is the actual band size different from the predicted?

References

ab81537 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for taking time to contact us. I am sorry to hear this antibody is not providing satisfactory results.

The details provided will enable us to investigate this case and will provide us with vital information for monitoring product quality. I appreciate the time you have spent in the laboratory and understand your concerns. It is regrettable the results have not been successful.

Having reviewed the protocol details, I believe this product should have given satisfactory results. It appears that you may have received a faulty vial.

Would you mind just letting us know for our records the amount of protein you loaded and the dilution you tried?

Could you also confirm your order number?

I apologize for the inconvenience and am pleased to offer you a refund. Just please let us know if that's your order number and I can process that for you.

Thank you for your cooperation. I look forward to hearing from you with details of how you would like to proceed.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up