Overview

  • Product name

    Anti-Ponticulin antibody
  • Description

    Rabbit polyclonal to Ponticulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity


    Predicted to work with: Dictyostelium discoideum
  • Immunogen

    Recombinant fragment corresponding to Ponticulin aa 23-118. Dictyostelium discoideum (Slime mold).
    Sequence:

    QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTF INAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS


    Database link: P54660

  • Positive control

    • WB: Recombinant Dictyostelium discoideum (Slime mold) Ponticulin protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab226000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 15 kDa (predicted molecular weight: 15 kDa).

Target

  • Relevance

    Function: Binds F-actin and nucleates actin assembly. Major high affinity link between the plasma membrane and the cortical actin network.
  • Cellular localization

    Cell Membrane
  • Database links

    • Alternative names

      • ponA antibody

    Images

    • All lanes : Anti-Ponticulin antibody (ab226000) at 1/500 dilution

      Lane 1 : Recombinant Dictyostelium discoideum (Slime mold) Ponticulin protein at 0.08 µg
      Lane 2 : Recombinant Dictyostelium discoideum (Slime mold) Ponticulin protein at 0.04 µg
      Lane 3 : Recombinant Dictyostelium discoideum (Slime mold) Ponticulin protein at 0.02 µg
      Lane 4 : Recombinant Dictyostelium discoideum (Slime mold) Ponticulin protein at 0.01 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

      Predicted band size: 15 kDa
      Observed band size: 15 kDa

    References

    ab226000 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab226000.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up