Overview

  • Product name

  • Description

    Rabbit polyclonal to POPDC2/POP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human POPDC2/POP2 aa 204-324.
    Sequence:

    TAETSCSYISWPRKSLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLF AKFGLRFDIRLPSLYHVLGPTAADAGPESEKGDEEVCEPAVSPPQATPTS LQQTPPCSTPPATTNFPAPPT


    Database link: Q9HBU9

  • Positive control

    • IHC-P: Human heart muscle tissue.
  • General notes

     This product was previously labelled as POPDC2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224121 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Important for the maintenance of cardiac function. Plays a regulatory function in heart rate dynamics mediated, at least in part, through cAMP-binding and, probably, by increasing cell surface expression of the potassium channel KCNK2 and enhancing current density.
  • Tissue specificity

    Expressed predominantly in the heart and in the skeletal muscle.
  • Sequence similarities

    Belongs to the popeye family.
  • Cellular localization

    Membrane. Cell membrane, sarcolemma.
  • Information by UniProt
  • Database links

  • Alternative names

    • POP 2 antibody
    • POP2 antibody
    • POPD2_HUMAN antibody
    • POPDC 2 antibody
    • Popdc2 antibody
    • Popeye domain containing 2 antibody
    • Popeye domain containing protein 2 antibody
    • Popeye domain-containing protein 2 antibody
    • Popeye protein 2 antibody
    see all

Images

  • Paraffin-embedded human heart muscle tissue stained for POPDC2/POP2 with ab224121 (1/200) in immunohistochemical analysis.

References

ab224121 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224121.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up