Overview

  • Product name

  • Description

    Mouse polyclonal to POT1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human POT1 aa 1-95. NP_056265
    Sequence:

    MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIV DQTNVKLTCLLFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQG


    Database link: Q9NUX5

  • Positive control

    • MES-SA/Dx5 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab194480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 71 kDa.

Target

  • Function

    Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity by itself. In contrast, the ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the telombin family.
  • Cellular localization

    Nucleus. Chromosome > telomere. Colocalizes with telomeric DNA.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP586D211 antibody
    • hPot 1 antibody
    • hPot1 antibody
    • POT 1 antibody
    • POT1 antibody
    • POT1 like telomere end-binding protein antibody
    • POT1 protection of telomeres 1 homolog antibody
    • POT1-like telomere end-binding protein antibody
    • POTE1_HUMAN antibody
    • Protection of telomeres 1 antibody
    • Protection of telomeres 1 homolog (S. pombe) antibody
    • Protection of telomeres protein 1 antibody
    see all

Images

  • Anti-POT1 antibody (ab194480) at 1/1000 dilution + recombinant immunogen at 0.2 µg

    Predicted band size: 71 kDa

  • Anti-POT1 antibody (ab194480) at 1/500 dilution + MES-SA/Dx5 cell lysate at 50 µg

    Predicted band size: 71 kDa

References

ab194480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (Human Bone Osteosarcoma (U2OS))
Permeabilization
Yes - 0.3% Triton X-100
Specification
Human Bone Osteosarcoma (U2OS)
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 10% · Temperature: RT°C
Fixative
PFA or MeOH

Abcam user community

Verified customer

Submitted May 04 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up