Overview

  • Product name

  • Description

    Rabbit polyclonal to POT1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human POT1 aa 250-432.
    Sequence:

    SMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTA NQHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLC AILKQKAPQQYRIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDI IFQDGATKTPDVKLQNTSLYDSKIWTTKNQKGR


    Database link: Q9NUX5

  • Positive control

    • IHC-P: Human skeletal muscle and testis tissues. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Component of the telomerase ribonucleoprotein (RNP) complex that is essential for the replication of chromosome termini. Is a component of the double-stranded telomeric DNA-binding TRF1 complex which is involved in the regulation of telomere length by cis-inhibition of telomerase. Also acts as a single-stranded telomeric DNA-binding protein and thus may act as a downstream effector of the TRF1 complex and may transduce information about telomere maintenance and/or length to the telomere terminus. Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Binds to two or more telomeric single-stranded 5'-TTAGGG-3' repeats (G-strand) and with high specificity to a minimal telomeric single-stranded 5'-TAGGGTTAG-3' sequence. Binds telomeric single-stranded sequences internally or at proximity of a 3'-end. Its activity is TERT dependent but it does not increase TERT activity by itself. In contrast, the ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the telombin family.
  • Cellular localization

    Nucleus. Chromosome > telomere. Colocalizes with telomeric DNA.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP586D211 antibody
    • hPot 1 antibody
    • hPot1 antibody
    • POT 1 antibody
    • POT1 antibody
    • POT1 like telomere end-binding protein antibody
    • POT1 protection of telomeres 1 homolog antibody
    • POT1-like telomere end-binding protein antibody
    • POTE1_HUMAN antibody
    • Protection of telomeres 1 antibody
    • Protection of telomeres 1 homolog (S. pombe) antibody
    • Protection of telomeres protein 1 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for POT1 with ab229803 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for POT1 with ab229803 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for POT1 (green) using ab229803 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab229803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up