Overview

  • Product name

    Anti-POU3F3/Brain1 antibody
    See all POU3F3/Brain1 primary antibodies
  • Description

    Rabbit polyclonal to POU3F3/Brain1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide corresponding to Human POU3F3/Brain1 aa 36-85 (N terminal).
    Sequence:

    GGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAAS


    Database link: NP_006227

  • Positive control

    • OVCAR-3 cell lysate
  • General notes

    Previously labelled as POU3F3. 

Properties

Applications

Our Abpromise guarantee covers the use of ab90727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Transcription factor that acts synergistically with SOX11 and SOX4. Plays a role in neuronal development. Is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').
  • Tissue specificity

    Brain.
  • Sequence similarities

    Belongs to the POU transcription factor family. Class-3 subfamily.
    Contains 1 homeobox DNA-binding domain.
    Contains 1 POU-specific domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Brain 1 antibody
    • Brain specific homeobox/POU domain protein 1 antibody
    • Brain-1 antibody
    • Brain-specific homeobox/POU domain protein 1 antibody
    • Brain-specific homeobox/POU domain protein 1.1 antibody
    • Brain1 antibody
    • BRN 1 antibody
    • Brn-1 antibody
    • BRN1 antibody
    • Brn1, mouse, homolog of antibody
    • class 3 antibody
    • Class III POU domain protein taichi antibody
    • Oct-8 antibody
    • Octamer-binding protein 8 antibody
    • Octamer-binding transcription factor 8 antibody
    • OTF 8 antibody
    • OTF-8 antibody
    • OTF8 antibody
    • PO3 F3 antibody
    • PO3F 3 antibody
    • PO3F3 antibody
    • PO3F3_HUMAN antibody
    • POU class 3 homeobox 3 antibody
    • POU domain antibody
    • POU domain protein 12 antibody
    • POU domain, class 3, transcription factor 3 antibody
    • POU domain, class 3, transcription factor 3-A antibody
    • pou12 antibody
    • POU3 F3 antibody
    • POU3F 3 antibody
    • Pou3f3 antibody
    • RHS 1 antibody
    • Rhs 2 antibody
    • RHS1 antibody
    • Rhs2 antibody
    • Skin 1 antibody
    • Skin1 antibody
    • tai-ji antibody
    • transcription factor 3 antibody
    • zp12 antibody
    • zp12pou antibody
    see all

Images

  • Western blot analysis of Human fetal lung tissue lysate labeling POU3F3/Brain1 with ab90727 at 1.0µg/ml.

  • Anti-POU3F3/Brain1 antibody (ab90727) at 1 µg/ml (in 5% skim milk / PBS buffer) + OVCAR-3 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 50 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Lin YJ  et al. NTF3 Is a Novel Target Gene of the Transcription Factor POU3F2 and Is Required for Neuronal Differentiation. Mol Neurobiol 55:8403-8413 (2018). Read more (PubMed: 29549646) »
  • Li W  et al. Increased levels of the long intergenic non-protein coding RNA POU3F3 promote DNA methylation in esophageal squamous cell carcinoma cells. Gastroenterology 146:1714-26.e5 (2014). WB ; Human . Read more (PubMed: 24631494) »
See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (brain)
Permeabilization
Yes - triton X-100
Specification
brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 29 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up