Overview

  • Product name
    Anti-POU6F1/Emb antibody
  • Description
    Rabbit polyclonal to POU6F1/Emb
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human POU6F1/Emb aa 252-301 (internal sequence). The exact sequence is proprietary.
    Sequence:

    YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP


    Database link: Q14863

  • Positive control
    • Fetal Kidney Nuclear Lysate. Human intestine.
  • General notes

     This product was previously labelled as POU6F1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab30944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/312500.
WB Use a concentration of 0.12 µg/ml. Detects a band of approximately 33 kDa (predicted molecular weight: 33 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

Images

  • Anti-POU6F1/Emb antibody (ab30944) at 0.12 µg/ml (in 5% skim milk / PBS buffer) + Fetal Kidney Nuclear Lysate

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 33 kDa
    Observed band size: 33 kDa

  • Immunohistochemical (Formalin/PFA-fixed paraffin-embedded sections) analysis human intestine tissue labelling POU6F1/Emb with ab30944 at 4µg/ml. Arrows indicate positively stained epithelial cells of intestinal villus.

References

ab30944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab30944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up