Overview

  • Product name

    Anti-POX antibody (Biotin)
  • Description

    Rabbit polyclonal to POX (Biotin)
  • Host species

    Rabbit
  • Conjugation

    Biotin
  • Tested applications

    Suitable for: WB, ELISAmore details
  • Species reactivity

    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli POX aa 1-572.
    Sequence:

    MKQTVAAYIAKTLESAGVKRIWGVTGDSLNGLSDSLNRMGTIEWMSTRHE EVAAFAAGAE AQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAI AAHIPSSEIGSGYFQETHPQEL FRECSHYCELVSSPEQIPQVLAIAMR KAVLNRGVSVVVLPGDVALKPAPEGATMHWYHAP QPVVTPEEEELRKL AQLLRYSSNIALMCGSGCAGAHKELVEFAGKIKAPIVHALRGKEHV EY DNPYDVGMTGLIGFSSGFHTMMNADTLVLLGTQFPYRAFYPTDAKIIQID INPASIGA HSKVDMALVGDIKSTLRALLPLVEEKADRKFLDKALEDYR DARKGLDDLAKPSEKAIHPQ YLAQQISHFAADDAIFTCDVGTPTVWAA RYLKMNGKRRLLGSFNHGSMANAMPQALGAQA TEPERQVVAMCGDGGF SMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMKAGGYLTDGT ELHD TNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEELAI PPQIKL EQAKGFSLYMLRAIISGRGDEVIELAKTNWLR


    Database link: P07003

  • General notes

    Previously labelled as poxB. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%,Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Associated products

Applications

Our Abpromise guarantee covers the use of ab193673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 59 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Cellular localization

    Cell Membrane
  • Database links

    • Alternative names

      • ECK0862 antibody
      • JW0855 antibody
      • POX antibody
      • poxB antibody
      • Pyruvate dehydrogenase (pyruvate oxidase), thiamin dependent, FAD binding antibody
      • Pyruvate dehydrogenase (pyruvate oxidase), thiamine triphosphate binding, FAD binding antibody
      • Pyruvate dehydrogenase [ubiquinone] antibody
      • Pyruvate oxidase antibody
      see all

    Images

    • All lanes : Anti-POX antibody (Biotin) (ab193673) at 0.25 µg/ml

      Lane 1 : Rosseta bacteria lysate at 40 µg
      Lane 2 : Rosseta bacteria lysate at 20 µg
      Lane 3 : Rosseta bacteria lysate at 10 µg
      Lane 4 : Rosseta bacteria lysate at 5 µg

      Secondary
      All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

      Predicted band size: 59 kDa
      Observed band size: 59 kDa

    References

    ab193673 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193673.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up