Overview

  • Product name

    Anti-PP-T antibody [2E11]
    See all PP-T primary antibodies
  • Description

    Mouse monoclonal [2E11] to PP-T
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human PP-T aa 2-499.
    Sequence:

    AMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFY SQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYR RAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECNKIVKQKAFERA IAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQ KKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLL NIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLLR GNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIM HGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRG VSCQFGPDVTKAFLEENNLDYIIRSHEVKAEGYEVAHGGRCVTVFSAPNY CDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYANTLLQLGMM


    Database link: P53041

  • Positive control

    • WB: A431, Jurkat and HEK-293 cell lysates. ICC/IF: HEK-293 and HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223355 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100.
WB 1/1000. Detects a band of approximately 58 kDa (predicted molecular weight: 56.9 kDa).

Target

  • Function

    May play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the PPP phosphatase family. PP-5 (PP-T) subfamily.
    Contains 3 TPR repeats.
  • Cellular localization

    Nucleus. Cytoplasm. Predominantly nuclear. But also present in the cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ36922 antibody
    • FLJ55954 antibody
    • OTTHUMP00000165834 antibody
    • PP-T antibody
    • PP5 antibody
    • PPP5 antibody
    • PPP5_HUMAN antibody
    • Ppp5c antibody
    • PPT antibody
    • Protein phosphatase 5, catalytic subunit antibody
    • Protein phosphatase T antibody
    • Serine/threonine protein phosphatase 5 antibody
    • Serine/threonine-protein phosphatase 5 antibody
    see all

Images

  • 2% formaldehyde-fixed HEK-293 (human epithelial cell line from embryonic kidney) cells stained for PP-T (green) using ab223355 at 1/50 dilution in ICC/IF. Secondary: Goat Anti-Mouse Alexa Fluor 488 at 1/100 dilution for 1 hour at RT. Counterstain: DAPI (blue) nuclear stain.

    (A) DAPI nuclear stain (B) ab223355 (C) Merge.

     

     

  • All lanes : Anti-PP-T antibody [2E11] (ab223355) at 1/500 dilution

    Lane 1 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 3 : Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate

    Lysates/proteins at 15 µg per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG HRP at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 56.9 kDa
    Observed band size: 58 kDa
    why is the actual band size different from the predicted?


    Exposure time: 6 minutes


    Blocking buffer: 5% skim milk.

    Primary and secondary antibodies were incubated for 1 hour at RT.

  •  4% formaldehyde-fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PP-T (green) using ab223355 at 1/100 dilution in ICC/IF. Secondary: Goat Anti-Mouse ATTO 488 at 1/100 dilution for 1 hour at RT. Counterstain: DAPI (blue) nuclear stain at 1/5000 for 5 min RT.

    (A) DAPI nuclear stain (B) ab223355 (C) Merge.

References

ab223355 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223355.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up