Overview

  • Product name

    Anti-PP2D1 antibody
  • Description

    Rabbit polyclonal to PP2D1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PP2D1 aa 236-312.
    Sequence:

    PSYQMTTDEQQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKA FAKAFWRMDRLLGLGRKEVSRVQWSGC


    Database link: A8MPX8

  • Positive control

    • Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221636 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Database links

  • Alternative names

    • C3orf48 antibody
    • PP2C-like domain-containing protein C3orf48 homolog antibody
    • PP2D1 antibody
    • PP2D1_HUMAN antibody
    • Protein phosphatase 2C-like domain containing 1 antibody
    • Protein phosphatase 2C-like domain-containing protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded human testis tissue stained for PP2D1 with ab221636 (1/2500).

     

     

References

ab221636 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221636.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up