Overview

  • Product name

  • Description

    Rabbit polyclonal to PPA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PPA2 aa 180-298.
    Sequence:

    CGEVIHVKILGILALIDEGETDWKLIAINANDPEASKFHDIDDVKKFKPG YLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALL MKKCNGGAINCTNVQISDS


    Database link: Q9H2U2

  • Positive control

    • WB: HeLa whole cell lysate; Mouse kidney and liver lysates; Rat kidney and liver lysates. IHC-P: Human prostate tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235102 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 38 kDa (predicted molecular weight: 38 kDa).
IHC-P 1/200 - 1/500.

Target

  • Tissue specificity

    Detected in brain, gastric carcinoma, lung, ovary, skeletal muscle, umbilical cord blood and a cell line derived from kidney proximal tubule epithelium.
  • Sequence similarities

    Belongs to the PPase family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • HSPC124 antibody
    • Inorganic pyrophosphatase 2 antibody
    • Inorganic pyrophosphatase 2, mitochondrial antibody
    • IPYR2_HUMAN antibody
    • mitochondrial antibody
    • Ppa2 antibody
    • PPase 2 antibody
    • PPase2 antibody
    • Pyrophosphatase (inorganic) 2 antibody
    • Pyrophosphatase SID6 306 antibody
    • Pyrophosphatase SID6-306 antibody
    • Pyrophosphate phospho-hydrolase 2 antibody
    • SID6 306 antibody
    see all

Images

  • All lanes : Anti-HOXD1 antibody (ab235103) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Rat kidney lysate
    Lane 3 : Rat liver lysate
    Lane 4 : Mouse kidney lysate
    Lane 5 : Mouse liver lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 38 kDa
    Observed band size: 35 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human protate tissue stained for PPA2 using ab235102 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Primary antibody (1% BSA) was incubated at 4°C overnight. The primary antibody was detected by a biotinylated secondary antibody and visualized using a HRP conjugated SP system.

References

ab235102 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235102.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up