Overview

  • Product name

    Anti-PPAP2A antibody [OTI1H4]
    See all PPAP2A primary antibodies
  • Description

    Mouse monoclonal [OTI1H4] to PPAP2A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Guinea pig
  • Immunogen

    Recombinant full length protein corresponding to Human PPAP2A aa 1-284.
    Sequence:

    MFDKTRLPYVALDVLCVLLAGLPFAILTSRHTPFQRGVFCNDESIKYPYK EDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATIYK AIGTFLFGAAASQSLTDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEY YICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAILVAVYVSDFF KERTSFKERKEEDSHTTLHETPTTGNHYPSNHQP


    Database link: NP_003702

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA. IHC-P: Human kidney, kidney carcinoma, liver, endometrium adenocarcinoma and lymph node tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab170151 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500. Predicted molecular weight: 32 kDa.
IHC-P 1/150.

Target

  • Function

    Broad-specificity phosphohydrolase that dephosphorylates exogenous bioactive glycerolipids and sphingolipids. Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). Pivotal regulator of lysophosphatidic acid (LPA) signaling in the cardiovascular system. Major enzyme responsible of dephosphorylating LPA in platelets, which terminates signaling actions of LPA. May control circulating, and possibly also regulate localized, LPA levels resulting from platelet activation. It has little activity towards ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P). The relative catalytic efficiency is LPA > PA > S-1-P > C-1-P. It's down-regulation may contribute to the development of colon adenocarcinoma.
  • Tissue specificity

    Ubiquitously expressed with highest expression found in prostate. Isoform 1 is predominant in kidney, lung, placenta and liver. Isoform 2 is predominant in heart and pancreas. Found to be down-regulated in colon adenocarcinomas.
  • Sequence similarities

    Belongs to the PA-phosphatase related phosphoesterase family.
  • Post-translational
    modifications

    N-glycosylated. Contains high-mannose oligosaccharides.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Lipid phosphate phosphohydrolase 1 antibody
    • Lipid phosphate phosphohydrolase 1a antibody
    • LLP1a antibody
    • LPP1 antibody
    • LPP1_HUMAN antibody
    • PAP 2a antibody
    • PAP-2a antibody
    • PAP2 antibody
    • PAP2-alpha antibody
    • PAP2a antibody
    • PAP2a2 antibody
    • PAP2alpha2 antibody
    • PAPalpha1 antibody
    • Phosphatidate phosphohydrolase type 2a antibody
    • Phosphatidic acid phosphatase 2a antibody
    • Phosphatidic acid phosphatase type 2A antibody
    • Phosphatidic acid phosphohydrolase type 2a antibody
    • PPAP2A antibody
    • Type 2 phosphatidic acid phosphatase alpha antibody
    • Type 2 phosphatidic acid phosphohydrolase antibody
    see all

Images

  • Paraffin-embedded human lymph node tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human endometrium adenocarcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney carcinoma tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for PPAP2A using ab170151 at 1/150 dilution in immunohistochemical analysis.

  • All lanes : Anti-PPAP2A antibody [OTI1H4] (ab170151) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PPAP2A cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 32 kDa

References

ab170151 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170151.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up