Overview

  • Product name

  • Description

    Rabbit polyclonal to PPAR alpha
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Guinea pig
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PPAR alpha aa 61-170. (Expressed in E.coli).
    Sequence:

    PGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKAS GYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHK CLSVGMSHNA


    Database link: Q07869

  • Positive control

    • WB: Recombinant human PPAR alpha protein; Pig skeletal muscle lysate. IHC-P: Human breast cancer, liver and liver cancer tissues.

Applications

Our Abpromise guarantee covers the use of ab233078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 52 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Ligand-activated transcription factor. Key regulator of lipid metabolism. Activated by the endogenous ligand 1-palmitoyl-2-oleoyl-sn-glycerol-3-phosphocholine (16:0/18:1-GPC). Activated by oleylethanolamide, a naturally occurring lipid that regulates satiety (By similarity). Receptor for peroxisome proliferators such as hypolipidemic drugs and fatty acids. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the ACOX1 and P450 genes. Transactivation activity requires heterodimerization with RXRA and is antagonized by NR2C2.
  • Tissue specificity

    Skeletal muscle, liver, heart and kidney.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • hPPAR antibody
    • MGC2237 antibody
    • MGC2452 antibody
    • NR1C1 antibody
    • Nuclear receptor subfamily 1 group C member 1 antibody
    • OTTHUMP00000197740 antibody
    • OTTHUMP00000197741 antibody
    • Peroxisome proliferative activated receptor alpha antibody
    • Peroxisome proliferator activated receptor alpha antibody
    • Peroxisome proliferator-activated receptor alpha antibody
    • PPAR antibody
    • PPAR-alpha antibody
    • ppara antibody
    • PPARA_HUMAN antibody
    • PPARalpha antibody
    see all

Images

  • Anti-PPAR alpha antibody (ab233078) at 3 µg/ml + Recombinant human PPAR alpha protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human liver cancer tissue stained for PPAR using ab233078 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PPAR alpha antibody (ab233078) at 3 µg/ml + Pig skeletal muscle lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 52 kDa

  • Paraffin-embedded human liver tissue stained for PPAR using ab233078 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human breast cancer tissue stained for PPAR using ab233078 at 20 µg/ml in immunohistochemical analysis. DAB staining.

References

ab233078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up