Overview

  • Product name

  • Description

    Rabbit polyclonal to PPCS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPCS aa 228-302.
    Sequence:

    ISFKLETDPAIVINRARKALEIYQHQVVVANILESRQSFVFIVTKDSETK LLLSEEEIEKGVEIEEKIVDNLQSR


    Database link: Q9HAB8

  • Positive control

    • Human smooth muscle tissue; RT-4, U-251 MG, Human liver and Human tonsil lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab204834 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Catalyzes the first step in the biosynthesis of coenzyme A from vitamin B5, where cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine.
  • Pathway

    Cofactor biosynthesis; coenzyme A biosynthesis; CoA from (R)-pantothenate: step 2/5.
  • Sequence similarities

    Belongs to the PPC synthetase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • COAB antibody
    • FLJ11838 antibody
    • MGC117357 antibody
    • MGC138220 antibody
    • OTTHUMP00000008433 antibody
    • Phosphopantothenate--cysteine ligase antibody
    • Phosphopantothenoylcysteine synthetase antibody
    • PPC synthetase antibody
    • Ppcs antibody
    • PPCS_HUMAN antibody
    • RP11-163G10.1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human smooth muscle tissue labeling PPCS with ab204834 at 1/50 dilution.

  • All lanes : Anti-PPCS antibody (ab204834) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 34 kDa

References

ab204834 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204834.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up