Overview

  • Product name

  • Description

    Rabbit polyclonal to PPFIA1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PPFIA1 aa 489-618.
    Sequence:

    QLEETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPM ADGHTDSYSTSAVLRRPQKGRLAALRDEPSKVQTLNEQDWERAQQASVLA NVAQAFESDADVSDGEDDRDTLLSSVDLLS


    Database link: Q13136

  • Positive control

    • Human testis tissue, RT-4 and U-251 lysates, U-2 OS cells.
  • General notes

    Previously labelled as Liprin alpha 1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab204406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 136 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    May regulate the disassembly of focal adhesions. May localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the liprin family. Liprin-alpha subfamily.
    Contains 3 SAM (sterile alpha motif) domains.
  • Domain

    The N-terminal coiled coil regions mediate homodimerization preferentially and heterodimerization type alpha/alpha. The C-terminal, non-coiled coil regions mediate heterodimerization type alpha/beta and interaction with PTPRD, PTPRF and PTPRS.
  • Cellular localization

    Cytoplasm. Colocalizes with PTPRF at the ends of focal adhesions most proximal to the cell nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ42630 antibody
    • HGNC:9245 antibody
    • LAR interacting protein 1 antibody
    • LAR-interacting protein 1 antibody
    • LIP 1 antibody
    • LIP-1 antibody
    • LIP.1 antibody
    • LIP1 antibody
    • LIPA1_HUMAN antibody
    • Liprin alpha 1 antibody
    • LIPRIN antibody
    • Liprin-alpha-1 antibody
    • MGC26800 antibody
    • PPFIA 1 antibody
    • PPFIA1 antibody
    • Protein tyrosine phosphatase receptor type f polypeptide (PTPRF) interacting protein (liprin) alpha 1 antibody
    • Protein tyrosine phosphatase receptor type f polypeptide interacting protein alpha 1 antibody
    • Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1 antibody
    • PTPRF interacting protein alpha 1 antibody
    • PTPRF-interacting protein alpha-1 antibody
    see all

Images

  • All lanes : Anti-ATP9A antibody (ab204404) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate

    Developed using the ECL technique.

    Predicted band size: 136 kDa

  • Immunofluorescent analysis of U-2 OS cells labeling PPFIA1 with ab204406 at 4 µg/mL. Fixation/Permeabilization: PFA/Triton X-100.

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling PPFIA1 with ab204406 antibody at 1/2500 dilution.

References

ab204406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up