Anti-PPIH antibody (ab235595)
Key features and details
- Rabbit polyclonal to PPIH
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PPIH antibody
See all PPIH primary antibodies -
Description
Rabbit polyclonal to PPIH -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Cow -
Immunogen
Recombinant full length protein corresponding to Human PPIH aa 2-177.
Sequence:AVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEF RKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFK LRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVM RKIENVPTGPNNKPKLPVVISQCGEM
Database link: O43447 -
Positive control
- WB: PC-3 whole cell lysate. IHC-P: Human tonsil tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab235595 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/20 - 1/200. | |
WB | 1/500 - 1/2000. Predicted molecular weight: 19 kDa. |
Target
-
Function
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Participates in pre-mRNA splicing. May play a role in the assembly of the U4/U5/U6 tri-snRNP complex. May act as a chaperone. -
Sequence similarities
Belongs to the cyclophilin-type PPIase family. PPIase H subfamily.
Contains 1 PPIase cyclophilin-type domain. -
Cellular localization
Nucleus speckle. Cytoplasm. Colocalizes with spliceosomal snRNPs. A small proportion may also be cytoplasmic. - Information by UniProt
-
Database links
- Entrez Gene: 513428 Cow
- Entrez Gene: 10465 Human
- Entrez Gene: 66101 Mouse
- Omim: 606095 Human
- SwissProt: Q0P5D0 Cow
- SwissProt: O43447 Human
- SwissProt: Q9D868 Mouse
- Unigene: 256639 Human
see all -
Alternative names
- Cyclophilin H antibody
- CYP-20 antibody
- CypH antibody
see all
Images
-
Anti-PPIH antibody (ab235595) at 1/500 dilution + PC-3 (human prostate adenocarcinoma cell line) whole cell lysate
Secondary
Goat polyclonal to rabbit at 1/10000 dilution
Predicted band size: 19 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPIH antibody (ab235595)
Paraffin-embedded human tonsil tissue stained for PPIH using ab235595 at 1/100 dilution in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab235595 has not yet been referenced specifically in any publications.