Overview

  • Product name

  • Description

    Rabbit polyclonal to PPIL2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PPIL2 aa 1-260.
    Sequence:

    MGKRQHQKDKMYITCAEYTHFYGGKKPDLPQTNFRRLPFDHCSLSLQPFV YPVCTPDGIVFDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFSKNSEGK YHCPVLFTVFTNNTHIVAVRTTGNVYAYEAVEQLNIKAKNFRDLLTDEPF SRQDIITLQDPTNLDKFNVSNFYHVKNNMKIIDPDEEKAKQDPSYYLKNT NAETRETLQELYKEFKGDEILAATMKAPEKKKVDKLNAAHYSTGKVSASF TSTAMVPETT


    Database link: Q13356

  • Positive control

    • IHC-P: Human liver cancer and prostate cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab230404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity

    Highest expression in thymus, pancreas and testis. Also detected in heart, placenta, lung, liver, skeletal muscle, kidney, spleen, prostate, ovary, small intestine and colon. Poorly detected in brain and leukocytes. Strong protein expression in lymph node (cortical, paracortical and medullar regions), thyroid (follicular epithelial cells), testis (developing spermatozoa), stomach (cells lining the gastric pit), pancreas, kidney (proximal and distal-tubule cells and collecting duct cells but not in glomeruli), endometrium and colon (goblet cells). Moderate protein expression in spleen, prostate (epithelium and squamous cell carcinomas), placenta and adrenal gland. Weak protein expression in liver, heart, breast, ovary, and lung. No protein expression in brain and bladder. High protein expression in most lymphomas and melanomas.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family. PPIL2 subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 1 U-box domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ39930 antibody
    • CYC4 antibody
    • Cyclophilin 60 antibody
    • Cyclophilin 60kDa antibody
    • Cyclophilin like protein Cyp 60 antibody
    • Cyclophilin-60 antibody
    • Cyclophilin-like protein Cyp-60 antibody
    • CYP60 antibody
    • hCyP 60 antibody
    • MGC33174 antibody
    • MGC787 antibody
    • Peptidyl prolyl cis trans isomerase like 2 antibody
    • Peptidyl-prolyl cis-trans isomerase-like 2 antibody
    • Peptidylprolyl cis trans isomerase antibody
    • Peptidylprolyl isomerase cyclophilin like 2 antibody
    • PPIase antibody
    • PPIL2 antibody
    • PPIL2_HUMAN antibody
    • Rotamase antibody
    • Rotamase PPIL2 antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for PPIL2 using ab230404 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for PPIL2 using ab230404 at 1/100 dilution in immunohistochemical analysis.

References

ab230404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up