Overview

  • Product name

    Anti-PPM1D/WIP1 antibody [OTI3E1]
    See all PPM1D/WIP1 primary antibodies
  • Description

    Mouse monoclonal [OTI3E1] to PPM1D/WIP1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPM1D/WIP1 aa 1-375. Produced in E.coli (NP_003611).
    Sequence:

    MAGLYSLGVSVFSDQGGRKYMEDVTQIVVEPEPTAEEKPSPRRSLSQPLP PRPSPAALPGGEVSGKGPAVAAREARDPLPDAGASPAPSRCCRRRSSVAF FAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAAIRKGFLACH LAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQ DDPKDDFVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPR LTHNGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHT LDPQKHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKML VNRALGRWRQRMLRADNTSAIVICI


    Database link: O15297

  • Positive control

    • WB: pCMV6-ENTRY PPM1D/WIP1 cDNA transfected HEK-293T cell lysate; HeLa and HEK-293T cell lysates.
  • General notes

     This product was previously labelled as PPM1D

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI3E1
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236515 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 67 kDa.

Target

  • Function

    Required for the relief of p53-dependent checkpoint mediated cell cycle arrest. Binds to and dephosphorylates 'Ser-15' of TP53 and 'Ser-345' of CHEK1 which contributes to the functional inactivation of these proteins.
  • Sequence similarities

    Belongs to the PP2C family.
    Contains 1 PP2C-like domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • EC 3.1.3.16 antibody
    • p53 induced protein phosphatase 1 antibody
    • p53-induced protein phosphatase 1 antibody
    • PP2C delta antibody
    • PP2C-delta antibody
    • PP2CD antibody
    • Ppm1d antibody
    • PPM1D_HUMAN antibody
    • Protein phosphatase 1D antibody
    • protein phosphatase 1D magnesium-dependent delta isoform antibody
    • Protein phosphatase 2C delta isoform antibody
    • Protein phosphatase 2C isoform delta antibody
    • Protein phosphatase magnesium dependent 1 delta antibody
    • Protein phosphatase magnesium-dependent 1 delta antibody
    • Protein phosphatase Mg2+/Mn2+ dependent 1D antibody
    • Protein phosphatase Wip1 antibody
    • Wild type p53 induced phosphatase 1 antibody
    • WIP 1 antibody
    • WIP1 antibody
    see all

Images

  • All lanes : Anti-PPM1D/WIP1 antibody [OTI3E1] (ab236515) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY PPM1D/WIP1 cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 67 kDa

  • Anti-PPM1D/WIP1 antibody [OTI3E1] (ab236515) at 1/500 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate at 35 µg

    Predicted band size: 67 kDa

  • Lanes 1-2 : Anti-PPM1D/WIP1 antibody [OTI3E1] (ab236515) at 1/200 dilution
    Lanes 3-4 : Anti-beta-Actin

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PPM1D.WIP1-Knockout HEK-293T cell lysate
    Lane 3 : HEK-293T cell lysate
    Lane 4 : PPM1D/WIP1-Knockout HEK-293T cell lysate

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 67 kDa

References

ab236515 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236515.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up