Overview

  • Product name

  • Description

    Rabbit polyclonal to PPM1K
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant fragment corresponding to Human PPM1K aa 278-362.
    Sequence:

    PETKRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVT EQAIQYGTEDNSTAVVVPFGAWGKYKNSEINFSFS


    Database link: Q8N3J5

  • Positive control

    • WB: PPM1K overexpression HEK-293T cell lysate. IHC-P: Human urinary bladder tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 41 kDa.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Regulates the mitochondrial permeability transition pore and is essential for cellular survival and development.
  • Sequence similarities

    Belongs to the PP2C family.
    Contains 1 PP2C-like domain.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • BDP antibody
    • mitochondrial antibody
    • MSUDMV antibody
    • PP2C domain containing protein phosphatase 1K antibody
    • PP2C domain-containing protein phosphatase 1K antibody
    • PP2C kappa antibody
    • PP2C like mitochondrial protein antibody
    • PP2C type mitochondrial phosphoprotein phosphatase antibody
    • PP2C-kappa antibody
    • PP2C-like mitochondrial protein antibody
    • PP2C-type mitochondrial phosphoprotein phosphatase antibody
    • PP2Ckappa antibody
    • PP2CM antibody
    • PPM1K antibody
    • PPM1K_HUMAN antibody
    • Protein phosphatase 1K antibody
    • Protein phosphatase 1K, mitochondrial antibody
    • Protein phosphatase 2C isoform kappa antibody
    • Protein phosphatase Mg2+/Mn2+ dependent 1K antibody
    • PTMP antibody
    • UG0882E07 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PPM1K (green) using ab224424 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human urinary bladder tissue stained for PPM1K using ab224424 at 1/200 dilution in immunohistochemical analysis.

  • All lanes : Anti-PPM1K antibody (ab224424) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed wth a large T antigen) cell lysate
    Lane 2 : PPM1K overexpression HEK-293T cell lysate (Co-expressed with a C-terminal myc-DDK tag, ~3.1 kDa)

    Predicted band size: 41 kDa

References

ab224424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up