Overview

  • Product name

  • Description

    Rabbit polyclonal to PPOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat PPOX aa 9-300. (Expressed in E.coli).
    Sequence:

    GGGISGLAASYHLTRSPSPPKVILVEGSKRLGGWIRSVRGSDGAIFELGP RGIRPAGALGARTLLLVSELGLESEVLPVRGDHPAAQNRFLYVGGALHPL PSGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEV ASLAMDSLCRGVFAGNSQELSIRSCFPSLFQAEQTHGSMLLGLLLGAGQT PQPNSSLIRQARAERWSQWSLRGGLEMLPQALHNYLTSKGVTILSGQPAC GLSLQPEGHWKVSLGDSSLEADHIISTIPASVLSKLLPAEAA


    Database link: D3ZVN7

  • Positive control

    • IHC-P: Rat small intestine, adrenal gland, heart, testis and stomach tissues. WB: Rat placenta lysate; Recombinant rat PPOX protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 51 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Pathway

    Porphyrin metabolism; protoporphyrin-IX biosynthesis; protoporphyrin-IX from protoporphyrinogen-IX: step 1/1.
  • Involvement in disease

    Defects in PPOX are the cause of variegate porphyria (VP) [MIM:176200]. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. PV is the most common form of porphyria in South Africa. It is characterized by skin hyperpigmentation and hypertrichosis, abdominal pain, tachycardia, hypertension and neuromuscular disturbances. High fecal levels of protoporphyrin and coproporphyrin, increased urine uroporphyrins and iron overload are typical markers of the disease.
  • Sequence similarities

    Belongs to the protoporphyrinogen oxidase family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC8485 antibody
    • PPO antibody
    • PPOX antibody
    • PPOX_HUMAN antibody
    • Protoporphyrinogen oxidase antibody
    • V290M antibody
    • Variegate porphyria antibody
    • VP antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded rat kidney tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat small intestine tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat adrenal gland tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat heart tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat testis tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for PPOX using ab231123 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PPOX antibody (ab231123) at 2 µg/ml + Recombinant rat PPOX protein

    Predicted band size: 51 kDa

  • Anti-PPOX antibody (ab231123) at 2 µg/ml + Rat placenta lysate

    Predicted band size: 51 kDa

References

ab231123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up