Overview

  • Product name

  • Description

    Rabbit polyclonal to PPOX
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Cynomolgus monkey
  • Immunogen

    Recombinant full length protein corresponding to Human PPOX aa 1-477.
    Sequence:

    MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPN GAIFELGPRGIRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLY VGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFA QRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLG LLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVS VLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQ LGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGAS YEGVAVNDCIESGRQAAVSVLGTEPNS


    Database link: P50336

  • Positive control

    • WB: A549 and HepG2 whole cell lysates. IHC-P: Human testis tissue. ICC/IF: PC-3 cells. IP: HepG2 whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 51 kDa.
IP 1/200 - 1/2000.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Pathway

    Porphyrin metabolism; protoporphyrin-IX biosynthesis; protoporphyrin-IX from protoporphyrinogen-IX: step 1/1.
  • Involvement in disease

    Defects in PPOX are the cause of variegate porphyria (VP) [MIM:176200]. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. PV is the most common form of porphyria in South Africa. It is characterized by skin hyperpigmentation and hypertrichosis, abdominal pain, tachycardia, hypertension and neuromuscular disturbances. High fecal levels of protoporphyrin and coproporphyrin, increased urine uroporphyrins and iron overload are typical markers of the disease.
  • Sequence similarities

    Belongs to the protoporphyrinogen oxidase family.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • MGC8485 antibody
    • PPO antibody
    • PPOX antibody
    • PPOX_HUMAN antibody
    • Protoporphyrinogen oxidase antibody
    • V290M antibody
    • Variegate porphyria antibody
    • VP antibody
    see all

Images

  • All lanes : Anti-PPOX antibody (ab236853) at 1/500 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 51 kDa

  • Paraffin-embedded human testis tissue stained for PPOX using ab236853 at 1/100 dilution in immunohistochemical analysis.

  • PC-3 (human prostate adenocarcinoma cell line) cells stained for PPOX (green) using ab236853 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

  • PPOX was immunoprecipitated from 500 µg HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab236853 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HepG2 whole cell lysate.

    Lane 2: ab236853 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 10 µg (Input).

References

ab236853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up