Overview

  • Product name

    Anti-PPP1A/PPP1CA antibody
    See all PPP1A/PPP1CA primary antibodies
  • Description

    Rabbit polyclonal to PPP1A/PPP1CA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Dog
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human PPP1A/PPP1CA aa 2-330. Expressed in E.coli.
    Sequence:

    SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPI LLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSL ETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKT FTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL CDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVV EDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADK NKGKYGQFSGLNPGGRPITPPRNSAKAKK


    Database link: P62136

  • Positive control

    • WB: Recombinant human PPP1A/PPP1CA protein; Pig cerebrum lysate; A431 and HeLa cell lysates; Human lung lysate. IHC-P: Human cerebrum, breast cancer and stomach tissue.
  • General notes

     This product was previously labelled as PPP1A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 38 kDa.

Target

  • Function

    Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. May play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca(2+)/calmodulin dependent protein kinase II. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
  • Sequence similarities

    Belongs to the PPP phosphatase family. PP-1 subfamily.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleoplasm. Nucleus > nucleolus. Primarily nuclear and largely excluded from the nucleolus. Highly mobile in cells and can be relocalized through interaction with targeting subunits. NOM1 plays a role in targeting this protein to the nucleolus. In the presence of PPP1R8 relocalizes from the nucleus to nuclear speckles.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha isoform serine threonine protein phosphatase PP1alpha 1 catalytic subunit antibody
    • Catalytic subunit antibody
    • EC 3.1.3.16 antibody
    • MGC15877 antibody
    • MGC1674 antibody
    • PP 1A antibody
    • PP-1A antibody
    • PP1A antibody
    • PP1A_HUMAN antibody
    • PP1alpha antibody
    • PP2C ALPHA antibody
    • PP2CA antibody
    • Ppp1ca antibody
    • Protein Phosphatase 2C Alpha Isoform antibody
    • Serine threonine protein phosphatase PP1 alpha catalytic subunit antibody
    • Serine threonine protein phosphatase PP1 alpha catalytic subunit protein phosphatase 1 antibody
    • Serine/threonine-protein phosphatase PP1-alpha catalytic subunit antibody
    see all

Images

  • Anti-PPP1A/PPP1CA antibody (ab232978) at 2 µg + Recombinant human PPP1A/PPP1CA protein

    Predicted band size: 38 kDa

  • Anti-PPP1A/PPP1CA antibody (ab232978) at 2 µg/ml + Pig cerebrum lysate

    Predicted band size: 38 kDa

  • Anti-PPP1A/PPP1CA antibody (ab232978) at 2 µg/ml + A431 (human epidermoid carcinoma cell line) cell lysate

    Predicted band size: 38 kDa

  • Anti-PPP1A/PPP1CA antibody (ab232978) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 38 kDa

  • Anti-PPP1A/PPP1CA antibody (ab232978) at 2 µg/ml + Human lung lysate

    Predicted band size: 38 kDa

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PPP1A/PPP1CA using ab232978 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human breast cancer tissue stained for PPP1A/PPP1CA using ab232978 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PPP1A/PPP1CA using ab232978 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up