Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP1CB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Chicken, Cow, Dog, Human, Pig, Xenopus laevis, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant full length protein corresponding to Mouse PPP1CB aa 2-327.
    Sequence:

    ADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPIL LELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLE TICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTF TDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLC DLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVE DGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKK AKYQYGGLNSGRPVTPPRTANPPKKR


    Database link: P62141

  • Positive control

    • WB: Rat liver tissue lysate.
  • General notes

     This product was previously labelled as Protein Phosphatase 1 beta, PPP1CA + 1CB

     

Properties

Applications

Our Abpromise guarantee covers the use of ab234690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 38 kDa (predicted molecular weight: 37 kDa).

Target

Images

  • Anti-PPP1CB antibody (ab234690) at 1/500 dilution + Rat liver tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 38 kDa
    why is the actual band size different from the predicted?

References

ab234690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up