For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ppp1r11-antibody-ab177043.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Share by email

Anti-PPP1R11 antibody (ab177043)

  • Datasheet
  • SDS
Reviews (2) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPP1R11 antibody (ab177043)
  • Western blot - Anti-PPP1R11 antibody (ab177043)

Key features and details

  • Rabbit polyclonal to PPP1R11
  • Suitable for: WB, IHC-P
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Protein
Product image
Recombinant Human PPP1R11 protein (ab167857)
Secondary
Product image
Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

View more associated products

Overview

  • Product name

    Anti-PPP1R11 antibody
    See all PPP1R11 primary antibodies
  • Description

    Rabbit polyclonal to PPP1R11
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chimpanzee, Rhesus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PPP1R11 aa 20-118. (BC102010).
    Sequence:

    TTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRA FGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQ


    Database link: O60927
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HepG2 cell lysate; Human stomach tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Lyophilized:Reconstitute in 200ul Sterile Distilled Water.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Positive Controls

    • HepG2 whole cell lysate (ab166833)
  • Recombinant Protein

    • Recombinant Human PPP1R11 protein (ab167857)
  • Related Products

    • Recombinant Human PPP1R11 protein (ab167857)

Applications

Our Abpromise guarantee covers the use of ab177043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 18 kDa (predicted molecular weight: 14 kDa).
IHC-P 1/100 - 1/500.

Target

  • Cellular localization

    Cytoplasmic
  • Database links

    • Entrez Gene: 742158 Chimpanzee
    • Entrez Gene: 6992 Human
    • Entrez Gene: 76497 Mouse
    • Entrez Gene: 294207 Rat
    • Omim: 606670 Human
    • SwissProt: Q7YR30 Chimpanzee
    • SwissProt: O60927 Human
    • SwissProt: Q8K1L5 Mouse
    • SwissProt: Q6MFY6 Rat
    • SwissProt: Q5TM51 Rhesus monkey
    • Unigene: 82887 Human
    • Unigene: 46176 Mouse
    • Unigene: 63970 Rat
    see all
  • Alternative names

    • HCG V antibody
    • HCG-V antibody
    • HCGV antibody
    • Hemochromatosis candidate gene V protein antibody
    • inhibitor-3 antibody
    • IPP3 antibody
    • protein phosphatase 1 regulatory subunit 11 antibody
    • protein phosphatase 1, regulatory (inhibitor) subunit 11 antibody
    • Protein phosphatase inhibitor 3 antibody
    • t-complex-associated-testis-expressed 5 antibody
    • TCTE5 antibody
    • TCTEX5 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPP1R11 antibody (ab177043)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PPP1R11 antibody (ab177043)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human stomach tissue labeling PPP1R11 with ab177043 at 1/100 dilution.

  • Western blot - Anti-PPP1R11 antibody (ab177043)
    Western blot - Anti-PPP1R11 antibody (ab177043)
    Anti-PPP1R11 antibody (ab177043) at 1/1000 dilution + HepG2 cell lysate

    Predicted band size: 14 kDa
    Observed band size: 18 kDa
    why is the actual band size different from the predicted?

Protocols

  • Western blot protocols
  • Immunohistochemistry protocols

Click here to view the general protocols

Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab177043? Please let us know so that we can cite the reference in this datasheet.

    ab177043 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-2 of 2 Abreviews or Q&A

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-PPP1R11 antibody

    Below Average
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Mouse Tissue sections (colon)
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Sodium citrate buffer
    Permeabilization
    No
    Specification
    colon
    Blocking step
    BSA as blocking agent for 30 minute(s) · Concentration: 3% · Temperature: RT°C
    Fixative
    Paraformaldehyde
    Read More

    Huihui Li

    Verified customer

    Submitted Oct 15 2015

    Western blot abreview for Anti-PPP1R11 antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Cell lysate - whole cell (colon)
    Gel Running Conditions
    Non-reduced Denaturing
    Loading amount
    50 µg
    Treatment
    transfected with siPPP1R11
    Specification
    colon
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
    Read More

    Huihui Li

    Verified customer

    Submitted Oct 15 2015

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.