Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP1R12C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPP1R12C aa 317-450.
    Sequence:

    DLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLSKERRPG GAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPF SRRFGLLKTGSSGALGPPERRTAEGAPGAGLQRS


    Database link: Q9BZL4

  • Positive control

    • IHC-P: Human heart tissue. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Regulates myosin phosphatase activity.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in heart.
  • Sequence similarities

    Contains 4 ANK repeats.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Along actomyosin filaments and stress fibers.
  • Information by UniProt
  • Database links

  • Alternative names

    • LENG 3 antibody
    • LENG3 antibody
    • leukocyte receptor cluster (LRC) encoded novel gene 3 antibody
    • leukocyte receptor cluster (LRC) member 3 antibody
    • MBS 85 antibody
    • MBS85 antibody
    • Myosin binding subunit 85 antibody
    • p84 antibody
    • p85 antibody
    • PP12C_HUMAN antibody
    • Ppp1r12c antibody
    • protein phosphatase 1 regulatory (inhibitor) subunit 12C antibody
    • protein phosphatase 1 myosin binding subunit of 85 kDa antibody
    • protein phosphatase 1 myosin binding subunit p85 antibody
    • Protein phosphatase 1 myosin-binding subunit of 85 kDa antibody
    • Protein phosphatase 1 myosin-binding subunit p85 antibody
    • Protein phosphatase 1 regulatory subunit 12C antibody
    see all

Images

  • Paraffin-embedded human heart tissue stained for PPP1R12C using ab234811 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling PPP1R12C using ab234811 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up