Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP1R15B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPP1R15B aa 282-363.
    Sequence:

    CPPLSTEGLPEIHHLRMKRLEFLQQASKGQDLPTPDQDNGYHSLEEEHSL LRMDPKHCRDNPTQFVPAAGDIPGNTQESTEE


    Database link: Q5SWA1

  • Positive control

    • SiHA cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220949 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    PPP1R15B belongs to the PPP1R15 family. It maintains low levels of EIF2S1 phosphorylation in un-stressed cells by promoting its dephosphorylation by PP1. The phosphatase activity of the PPP1R15B-PP1 complex toward EIF2S1 is specifically inhibited by Salubrinal, a drug that protects cells from endoplasmic reticulum stress.
  • Database links

  • Alternative names

    • CREP antibody
    • FLJ14744 antibody
    • PPP1R15B antibody
    • Protein phosphatase 1, regulatory (inhibitor) subunit 15B antibody
    • Protein phosphatase 1, regulatory subunit 15B antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized SiHA cells labeling PPP1R15B with ab220949 at 4 μg/ml dilution (green). 

References

ab220949 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220949.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up