Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP1R3B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PPP1R3B aa 1-285.
    Sequence:

    MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMV APAVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDMPFNITELLDNIV SLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVLKDKAIAGTVK VQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPE KIQSYERMEFAVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGP DLGISFDQFGSPRCSYGLFPEWPSYLGYEKLGPYY


    Database link: Q86XI6

  • Positive control

    • WB: Rat heart and mouse liver tissue lysate. IHC-P: Human skeletal muscle and liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235049 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Function

    Acts as a glycogen-targeting subunit for phosphatase PP1. Facilitates interaction of the PP1 with enzymes of the glycogen metabolism and regulates its activity. Suppresses the rate at which PP1 dephosphorylates (inactivates) glycogen phosphorylase and enhances the rate at which it activates glycogen synthase and therefore limits glycogen breakdown. Its activity is inhibited by PYGL, resulting in inhibition of the glycogen synthase and glycogen phosphorylase phosphatase activities of PP1. Dramatically increases basal and insulin-stimulated glycogen synthesis upon overexpression in hepatocytes.
  • Tissue specificity

    Highly expressed in liver. Expressed moderately in skeletal muscle and myotubes (at protein level). Expressed predominantly in heart and skeletal muscle. Expressed moderately in liver. Expressed weakly in placenta, lung and kidney.
  • Sequence similarities

    Contains 1 CBM21 (carbohydrate binding type-21) domain.
  • Domain

    The N-terminal region is required for binding to PP1, the central region is required for binding to glycogen and the C-terminal region is required for binding to PYGL.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ14005 antibody
    • FLJ34675 antibody
    • GL antibody
    • Hepatic glycogen targeting protein phosphatase 1 regulatory subunit GL antibody
    • Hepatic glycogen targeting subunit G(L) antibody
    • Hepatic glycogen-targeting protein phosphatase 1 regulatory subunit GL antibody
    • PP1 subunit R4 antibody
    • Ppp1r3b antibody
    • PPP1R4 antibody
    • PPR3B_HUMAN antibody
    • Protein phosphatase 1 regulatory (inhibitor) subunit 3B antibody
    • Protein phosphatase 1 regulatory subunit 3B antibody
    • Protein phosphatase 1 regulatory subunit 4 antibody
    • Protein phosphatase 1 subunit 4 antibody
    • Protein phosphatase 1 subunit GL antibody
    • PTG antibody
    • R4 antibody
    see all

Images

  • Anti-PPP1R3B antibody (ab235049) at 1/500 dilution + Mouse liver tissue lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution
  • Paraffin-embedded human liver tissue stained for PPP1R3B using ab235049 at 1/100 dilution in immunohistochemical analysis.

  • Anti-PPP1R3B antibody (ab235049) at 1/500 dilution + Rat heart tissue lysate

    Secondary
    Goat polyclonal to rabbit at 1/50000 dilution
  • Paraffin-embedded human skeletal muscle tissue stained for PPP1R3B using ab235049 at 1/100 dilution in immunohistochemical analysis.

References

ab235049 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235049.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up