Overview

  • Product name

    Anti-PPP1R3F antibody
  • Description

    Rabbit polyclonal to PPP1R3F
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PPP1R3F aa 516-619.
    Sequence:

    TDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARLGRGVE LIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGD VWLP


    Database link: Q6ZSY5

  • Positive control

    • MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab219956 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

Images

References

ab219956 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219956.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up