Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP2R2A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Pig, Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human PPP2R2A aa 46-255. (BC041071).
    Sequence:

    GDKGGRVVIFQQEQENKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEK INKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRD PTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSA DDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYS SSKGTIRLCD


    Database link: P63151

  • Positive control

    • HepG2 and Human fetal kidney lysates; Human fetal colon tissue.

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab197194 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/1000 - 1/2000. Predicted molecular weight: 52 kDa.

Target

  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Tissue specificity

    Expressed in all tissues examined.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2ABA_HUMAN antibody
    • Alpha isoform of regulatory subunit B55 protein phosphatase 2 antibody
    • B55A antibody
    • B55ALPHA antibody
    • calcineurin antibody
    • PP2A subunit B B alpha isoform antibody
    • PP2A subunit B B55 alpha isoform antibody
    • PP2A subunit B isoform alpha antibody
    • PP2A subunit B isoform B55-alpha antibody
    • PP2A subunit B isoform PR55-alpha antibody
    • PP2A subunit B isoform R2-alpha antibody
    • PP2A subunit B PR55 alpha isoform antibody
    • PP2A subunit B R2 alpha isoform antibody
    • PPP2R2A antibody
    • PR52A antibody
    • PR55A antibody
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B (PR 52) alpha isoform antibody
    • Protein phosphatase 2 (formerly 2A), regulatory subunit B (PR52), alpha isoform antibody
    • Protein phosphatase 2 regulatory subunit B alpha antibody
    • Protein phosphatase 2 regulatory subunit B alpha isoform antibody
    • Protein phosphatase 2 regulatory subunit Balpha antibody
    • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform antibody
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform antibody
    • Testicular tissue protein Li 156 antibody
    see all

Images

  • All lanes : Anti-PPP2R2A antibody (ab197194) at 1/500 dilution

    Lane 1 : HepG2 cell lysate
    Lane 2 : Human fetal kidney lysate

    Predicted band size: 52 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal colon tissue labeling PPP2R2A with ab197194 at 1/100 dilution.

References

ab197194 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197194.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up