For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ppp2r2c-antibody-ab172086.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Ser / Thr Phosphatases
Share by email

Anti-PPP2R2C antibody (ab172086)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-PPP2R2C antibody (ab172086)

    Key features and details

    • Mouse polyclonal to PPP2R2C
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Mouse IgG H&L (HRP) (ab205719)

    View more associated products

    Overview

    • Product name

      Anti-PPP2R2C antibody
      See all PPP2R2C primary antibodies
    • Description

      Mouse polyclonal to PPP2R2C
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Pig, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis
    • Immunogen

      Recombinant full length protein corresponding to Human PPP2R2C aa 1-430. Isoform 3 (AAH32954.1)
      Sequence:

      MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKL WKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRI FANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPAN MEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEE PEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIE TYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDR NTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILH TAWHPAENIIAIAATNNLYIFQDKVNSDMH


      Database link: Q9Y2T4-3
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • PPP2R2C-transfected 293T cell lysate.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.4
      Constituent: 100% PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Signal Transduction
      • Protein Phosphorylation
      • Ser / Thr Phosphatases

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG - Isotype Control (ab37355)

    Applications

    Our Abpromise guarantee covers the use of ab172086 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa.

    Target

    • Function

      The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
    • Sequence similarities

      Belongs to the phosphatase 2A regulatory subunit B family.
      Contains 7 WD repeats.
    • Target information above from: UniProt accession Q9Y2T4 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 422858 Chicken
      • Entrez Gene: 782110 Cow
      • Entrez Gene: 5522 Human
      • Entrez Gene: 269643 Mouse
      • Entrez Gene: 100521101 Pig
      • Entrez Gene: 117256 Rat
      • Entrez Gene: 100002802 Zebrafish
      • Omim: 605997 Human
      • SwissProt: Q95LP0 Cynomolgus monkey
      • SwissProt: Q9Y2T4 Human
      • SwissProt: Q8BG02 Mouse
      • SwissProt: P50410 Rabbit
      • SwissProt: P97888 Rat
      • Unigene: 479069 Human
      • Unigene: 41694 Mouse
      • Unigene: 54550 Rat
      see all
    • Alternative names

      • 2ABG_HUMAN antibody
      • B55 gamma antibody
      • Gamma isoform of regulatory subunit B55 protein phosphatase 2 antibody
      • IMYPNO 1 antibody
      • IMYPNO antibody
      • IMYPNO1 antibody
      • MGC33570 antibody
      • OTTHUMP00000115505 antibody
      • Phosphoprotein phosphatase 2A BR gamma regulatory chain antibody
      • PP2A subunit B B gamma isoform antibody
      • PP2A subunit B B55 gamma isoform antibody
      • PP2A subunit B isoform B55-gamma antibody
      • PP2A subunit B isoform gamma antibody
      • PP2A subunit B isoform PR55-gamma antibody
      • PP2A subunit B isoform R2-gamma antibody
      • PP2A subunit B PR55 gamma isoform antibody
      • PP2A subunit B R2 gamma isoform antibody
      • PPP2R2C antibody
      • PPP2R2C protein antibody
      • PR 52 antibody
      • PR 55G antibody
      • PR52 antibody
      • PR55G antibody
      • Protein phosphatase 2 (formerly 2A) regulatory subunit B gamma isoform antibody
      • Protein phosphatase 2 regulatory subunit B gamma antibody
      • Protein phosphatase 2 regulatory subunit B gamma isoform antibody
      • Protein phosphatase 2A1 B gamma subunit antibody
      • Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform antibody
      • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform antibody
      see all

    Images

    • Western blot - Anti-PPP2R2C antibody (ab172086)
      Western blot - Anti-PPP2R2C antibody (ab172086)
      All lanes : Anti-PPP2R2C antibody (ab172086) at 1 µg/ml

      Lane 1 : PPP2R2C-transfected 293T cell lysate
      Lane 2 : Non-transfected 293T cell lysate

      Lysates/proteins at 15 µl per lane.

      Secondary
      All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution

      Developed using the ECL technique.

      Predicted band size: 49 kDa

    Protocols

    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab172086? Please let us know so that we can cite the reference in this datasheet.

    ab172086 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab172086.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.