Anti-PPP2R2C antibody (ab172086)
Key features and details
- Mouse polyclonal to PPP2R2C
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PPP2R2C antibody
See all PPP2R2C primary antibodies -
Description
Mouse polyclonal to PPP2R2C -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Pig, Xenopus laevis, Zebrafish, Cynomolgus monkey, Orangutan, Xenopus tropicalis -
Immunogen
Recombinant full length protein corresponding to Human PPP2R2C aa 1-430. Isoform 3 (AAH32954.1)
Sequence:MGKRDTADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEY DVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKL WKITERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRI FANGHTYHINSISVNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPAN MEDLTEVITASEFHPHHCNLFVYSSSKGSLRLCDMRAAALCDKHSKLFEE PEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRDYLTVKVWDLNMEARPIE TYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNNFFRMFDR NTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILH TAWHPAENIIAIAATNNLYIFQDKVNSDMH
Database link: Q9Y2T4-3 -
Positive control
- PPP2R2C-transfected 293T cell lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab172086 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 49 kDa. |
Target
-
Function
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. -
Sequence similarities
Belongs to the phosphatase 2A regulatory subunit B family.
Contains 7 WD repeats. - Information by UniProt
-
Database links
- Entrez Gene: 422858 Chicken
- Entrez Gene: 782110 Cow
- Entrez Gene: 5522 Human
- Entrez Gene: 269643 Mouse
- Entrez Gene: 100521101 Pig
- Entrez Gene: 117256 Rat
- Entrez Gene: 100002802 Zebrafish
- Omim: 605997 Human
see all -
Alternative names
- 2ABG_HUMAN antibody
- B55 gamma antibody
- Gamma isoform of regulatory subunit B55 protein phosphatase 2 antibody
see all
Images
-
All lanes : Anti-PPP2R2C antibody (ab172086) at 1 µg/ml
Lane 1 : PPP2R2C-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 49 kDa
Datasheets and documents
References (0)
ab172086 has not yet been referenced specifically in any publications.