Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP2R2D
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Xenopus laevis, Zebrafish, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human PPP2R2D aa 1-192.
    Sequence:

    MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLA TGDKGGRVVIFQREQENKSRPHSRGEYNVYSTFQSHEPEFDYLKSLEIEE KINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGYNLKDEDGRLR DPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVN


    Database link: Q66LE6

  • Positive control

    • WB: SH-SY5Y, HeLa and HEK-293T whole cell lysates. IHC-P: Human prostate cancer and glioma cancer tissues. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab229863 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 52 kDa.

Target

  • Function

    B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B family.
    Contains 7 WD repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2ABD_HUMAN antibody
    • MDS026 antibody
    • PP2A subunit B isoform B55-delta antibody
    • PP2A subunit B isoform delta antibody
    • PP2A subunit B isoform PR55-delta antibody
    • PP2A subunit B isoform R2-delta antibody
    • PPP2R2D antibody
    • Protein phosphatase 2 regulatory subunit B delta antibody
    • Protein phosphatase 2 regulatory subunit B delta isoform antibody
    • Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform antibody
    see all

Images

  • All lanes : Anti-PPP2R2D antibody (ab229863) at 1/1000 dilution

    Lane 1 : SH-SY5Y (human neuroblastoma cell line from bone marrow) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 52 kDa
    Observed band size: 52,40 kDa
    why is the actual band size different from the predicted?

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PPP2RD (green) using ab229863 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L) secondary antibody.

  • Paraffin-embedded human glioma tissue stained for PPP2RD using ab229863 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for PP2R2D using ab229863 at 1/100 dilution in immunohistochemical analysis.

References

ab229863 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229863.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up