Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP2R3B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PPP2R3B aa 356-575.
    Sequence:

    FSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGD GALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITL QDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKY AAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPS PLGAVDLYEYACGDEDLEPL


    Database link: Q9Y5P8-1

  • Positive control

    • WB: HL-60 whole cell lysate. IHC-P: Human adrenal gland and liver cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Detects a band of approximately 66 kDa (predicted molecular weight: 65 kDa).
IHC-P 1/20 - 1/200.

Target

  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
  • Sequence similarities

    Contains 1 EF-hand domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • NY REN 8 antibody
    • NY REN 8 antigen antibody
    • P2R3B_HUMAN antibody
    • PP2A B'' subunit PR48 antibody
    • PP2A subunit B isoform PR48 antibody
    • PP2A subunit B PR48 isoform antibody
    • PPP2R3B antibody
    • PPP2R3L antibody
    • PPP2R3LY antibody
    • PR 48 antibody
    • PR48 antibody
    • Protein phosphatase 2 (formerly 2A) regulatory subunit B'' beta antibody
    • Protein phosphatase 2 regulatory subunit B'' beta antibody
    • Protein phosphatase 2A 48 kDa regulatory subunit antibody
    • Serine/threonine protein phosphatase 2A 48kDa regulatory subunit B antibody
    • Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta antibody
    see all

Images

  • Anti-PPP2R3B antibody (ab234731) at 1/1000 dilution + HL-60 (human promyelocytic leukemia cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 65 kDa
    Observed band size: 66 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human adrenal gland tissue stained for PPP2R3B with ab234731 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver cancer tissue stained for PPP2R3B with ab234731 at 1/100 dilution in immunohistochemical analysis.

References

ab234731 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up