Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP2R4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Rabbit, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Rat PPP2R4 aa 1-323. (Expressed in E.coli).
    Sequence:

    MAEGERQPPPDSSEETPSATPTFIIPKKEIHTVPDMGKWKRSQAYADYIG FILTLNEGVKGKKLTFDYKVSEAIEKLVALLDTLDRWIDETPPVDQPSRF GNKAYRTWYAKLDQEAENLVATVIPTNLAAAVPEVAVYLKEAVGNSTRID YGTGHEAAFAAFLCCLCKIGVLRVDDQVAIVFKVFDRYLEVMRKLQKTYR MEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPHLEPRHFVDEKAVSENHKD YMFLQCILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL EKFPVIQHFKFGSLLPIHPVTSG


    Database link: B2RYQ2

  • Positive control

    • IHC-P: Rat testis and stomach tissues. WB: Rat serum; Rat testis and brain lysates; Recombinant rat PPP2R4 protein.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231129 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231129 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 37 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Acts as a regulatory subunit for serine/threonine-protein phosphatase 2A (PP2A) modulating its activity or substrate specificity, probably by inducing a conformational change in the catalytic subunit, a proposed direct target of the PPIase. Can reactivate inactive phosphatase PP2A-phosphatase methylesterase complexes (PP2A(i)) in presence of ATP and Mg(2+) (By similarity). Reversibly stimulates the variable phosphotyrosyl phosphatase activity of PP2A core heterodimer PP2A(D) in presence of ATP and Mg(2+) (in vitro). The phosphotyrosyl phosphatase activity is dependent of an ATPase activty of the PP2A(D):PPP2R4 complex. Is involved in apoptosis; the function appears to be independent from PP2A.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the PTPA-type PPIase family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • subunit B'' antibody
    • KIAA0044 antibody
    • MGC2184 antibody
    • Phosphotyrosyl phosphatase activator antibody
    • PP2A antibody
    • PP2A phosphatase activator antibody
    • PP2A subunit B' antibody
    • PP2A subunit B' isoform PR53 antibody
    • PP2A subunit B' PR53 isoform antibody
    • PPP2R4 antibody
    • PR53 antibody
    • PR53 isoform antibody
    • Protein phosphatase 2, regulatory subunit B-prime antibody
    • Protein phosphatase 2A activator regulatory subunit 4 antibody
    • Protein phosphatase 2A regulatory subunit B' (PR 53) antibody
    • PTPA antibody
    • PTPA_HUMAN antibody
    • Serine/threonine protein phosphatase 2A regulatory subunit B' antibody
    • Serine/threonine-protein phosphatase 2A activator antibody
    • Serine/threonine-protein phosphatase 2A regulatory subunit 4 antibody
    • Serine/threonine-protein phosphatase 2A regulatory subunit B'' antibody
    see all

Images

  • Paraffin-embedded rat testis tissue stained for PPP2R4 using ab231129 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded rat stomach tissue stained for PPP2R4 using ab231129 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Recombinant rat PPP2R4 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 37 kDa

  • All lanes : Anti-PPP2R4 antibody (ab231129) at 1 µg/ml

    Lane 1 : Rat serum
    Lane 2 : Rat testis lysate
    Lane 3 : Rat brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 37 kDa

References

ab231129 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231129.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up