Overview

  • Product name

  • Description

    Rabbit polyclonal to PPP2R5C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human PPP2R5C aa 1-524.
    Sequence:

    MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCC VLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA VNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDF QPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYI RKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKV LLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEM NQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKIENLAKANPQYTVYSQAS TMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDRPLARRKSELP QDPHTKKALEAHCRADELASQDGR


    Database link: Q13362

Properties

Applications

Our Abpromise guarantee covers the use of ab192371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 61 kDa.
IHC-P Use at an assay dependent concentration.

Target

  • Function

    The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. The PP2A-PPP2R5C holoenzyme may specifically dephosphorylate and activate TP53 and play a role in DNA damage-induced inhibition of cell proliferation. PP2A-PPP2R5C may also regulate the ERK signaling pathway through ERK dephosphorylation.
  • Tissue specificity

    Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
  • Sequence similarities

    Belongs to the phosphatase 2A regulatory subunit B56 family.
  • Post-translational
    modifications

    Isoform Gamma-3 is phosphorylated on serine residues. Isoform Gamma-1 phosphorylation by ERK2 is IER3-dependent and inhibits ERK dephosphorylation by PP2A-PPP2R5C.
  • Cellular localization

    Nucleus. Chromosome > centromere.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2A5G_HUMAN antibody
    • B' alpha regulatory subunit antibody
    • B56G antibody
    • KIAA0044 antibody
    • MGC23064 antibody
    • PP2A B subunit B' gamma isoform antibody
    • PP2A B subunit B56 gamma isoform antibody
    • PP2A B subunit isoform B' gamma antibody
    • PP2A B subunit isoform B''-gamma antibody
    • PP2A B subunit isoform B56-gamma antibody
    • PP2A B subunit isoform PR61-gamma antibody
    • PP2A B subunit isoform R5-gamma antibody
    • PP2A B subunit PR61 gamma isoform antibody
    • PP2A B subunit R5 gamma isoform antibody
    • Ppp2r5c antibody
    • PR61G antibody
    • Protein phosphatase 2 regulatory subunit B (B56) gamma isoform antibody
    • Protein phosphatase 2 regulatory subunit B' gamma antibody
    • Protein phosphatase 2, regulatory subunit B', gamma isoform antibody
    • Renal carcinoma antigen NY REN 29 antibody
    • Renal carcinoma antigen NY-REN-29 antibody
    • Serine/threonine protein phosphatase 2A 56 kDa regulatory subunit gamma isoform antibody
    • Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform antibody
    see all

References

ab192371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up