Anti-PPP3R2 antibody (ab172099)
Key features and details
- Mouse polyclonal to PPP3R2
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PPP3R2 antibody -
Description
Mouse polyclonal to PPP3R2 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Cow
-
Immunogen
Full length protein corresponding to Human PPP3R2 aa 1-173.
Sequence:MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLP ELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFS IYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGK ISFEEFSAVVRDLEIHKKLVLIV
Database link: NP_671709.1 -
Positive control
- Lysate from 293T cells transfected with PPP3R2.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading... -
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab172099 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa. |
Target
-
Function
Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. -
Tissue specificity
Testis-specific. -
Sequence similarities
Belongs to the calcineurin regulatory subunit family.
Contains 4 EF-hand domains. - Information by UniProt
-
Database links
- Entrez Gene: 617585 Cow
- Entrez Gene: 5535 Human
- Omim: 613821 Human
- SwissProt: Q2TBI5 Cow
- SwissProt: Q96LZ3 Human
- Unigene: 151167 Human
-
Alternative names
- Calcineurin B like protein antibody
- Calcineurin B type II (19kDa) antibody
- Calcineurin B type II antibody
see all
Images
-
Western blot - Anti-PPP3R2 antibody (ab172099)All lanes : Anti-PPP3R2 antibody (ab172099) at 1 µg/ml
Lane 1 : Lysate from 293T cells transfected with PPP3R2
Lane 2 : Lysate from untransfected 293T cells
Lysates/proteins at 15 µg per lane.
Predicted band size: 20 kDa
Datasheets and documents
References (0)
ab172099 has not yet been referenced specifically in any publications.
