Anti-PRCP antibody (ab231526)
Key features and details
- Rabbit polyclonal to PRCP
- Suitable for: IHC-P, WB
- Reacts with: Mouse
- Isotype: IgG
Overview
-
Product name
Anti-PRCP antibody
See all PRCP primary antibodies -
Description
Rabbit polyclonal to PRCP -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Mouse -
Immunogen
Recombinant fragment corresponding to Mouse PRCP aa 169-443. (N-terminal His and GST Tag; Expressed in E.coli).
Sequence:QPVIAIGGSYGGMLAAWFRMKYPHIVVGALAASAPIWQLDGMVPCGEFMK IVTNDFRKSGPYCSESIRKSWNVIDKLSGSGSGLQSLTNILHLCSPLTSE KIPTLKGWIAETWVNLAMVNYPYACNFLQPLPAWPIKEVCQYLKNPNVSD TVLLQNIFQALSVYYNYSGQAACLNISQTTTSSLGSMGWSFQACTEMVMP FCTNGIDDMFEPFLWDLEKYSNDCFNQWGVKPRPHWMTTMYGGKNISSHS NIIFSNGELDPWSGGGVTRDITDTL
Database link: Q7TMR0 -
Positive control
- IHC-P: Mouse kidney tissue. WB: Mouse kidney lysate; Recombinant mouse PRCP protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231526 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231526 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 56 kDa. |
Target
-
Function
Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH. -
Tissue specificity
Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney. -
Sequence similarities
Belongs to the peptidase S28 family. -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 72461 Mouse
- SwissProt: Q7TMR0 Mouse
- Unigene: 389969 Mouse
-
Alternative names
- Angiotensinase C antibody
- HUMPCP antibody
- Lysosomal carboxypeptidase C antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PRCP antibody (ab231526)
Formalin-fixed, paraffin-embedded mouse kidney tissue stained for PRCP using ab231526 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-PRCP antibody (ab231526) at 2 µg/ml + Recombinant mouse PRCP protein
Predicted band size: 56 kDa -
Anti-PRCP antibody (ab231526) at 2 µg/ml + Mouse kidney lysate
Predicted band size: 56 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231526 has not yet been referenced specifically in any publications.