Overview

  • Product name

  • Description

    Rabbit polyclonal to PRD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human PRD aa 360-409 (internal sequence).
    Sequence:

    GAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVL


    Database link: NP_000276

  • Positive control

    • Human placenta lysate
  • General notes

     This product was previously labelled as PEPD

     

Properties

Applications

Our Abpromise guarantee covers the use of ab86507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Splits dipeptides with a prolyl or hydroxyprolyl residue in the C-terminal position. Plays an important role in collagen metabolism because the high level of iminoacids in collagen.
  • Involvement in disease

    Defects in PEPD are a cause of prolidase deficiency (PD) [MIM:170100]. Prolidase deficiency is an autosomal recessive disorder associated with iminodipeptiduria. The clinical phenotype includes skin ulcers, mental retardation, recurrent infections, and a characteristic facies. These features, however are incompletely penetrant and highly variable in both age of onset and severity. There is a tight linkage between the polymorphisms of prolidase and the myotonic dystrophy trait.
  • Sequence similarities

    Belongs to the peptidase M24B family. Eukaryotic-type prolidase subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aminoacyl L proline hydrolase antibody
    • Imidodipeptidase antibody
    • MGC10905 antibody
    • MGC95081 antibody
    • Pep 4 antibody
    • Pep4 antibody
    • pepD antibody
    • PEPD_HUMAN antibody
    • Peptidase 4 antibody
    • Peptidase D antibody
    • Prolidase antibody
    • Proline dipeptidase antibody
    • X pro dipeptidase antibody
    • X-Pro dipeptidase antibody
    • Xaa-Pro dipeptidase antibody
    see all

Images

  • Anti-PRD antibody (ab86507) at 1 µg/ml + human placenta lysate at 10 µg

    Secondary
    anti-Rabbit IgG HRP at 1/50000 dilution

    Predicted band size: 55 kDa
    Observed band size: 55 kDa

References

This product has been referenced in:

  • Yang L  et al. PEPD is a pivotal regulator of p53 tumor suppressor. Nat Commun 8:2052 (2017). Read more (PubMed: 29233996) »
  • Szoka L  et al. Exogenous proline stimulates type I collagen and HIF-1a expression and the process is attenuated by glutamine in human skin fibroblasts. Mol Cell Biochem 435:197-206 (2017). Human . Read more (PubMed: 28526934) »
See all 7 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up