Overview

  • Product name

    Anti-PRDC antibody - C-terminal
    See all PRDC primary antibodies
  • Description

    Rabbit polyclonal to PRDC - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Synthetic peptide within Human PRDC aa 107-168 (C terminal). The exact sequence is proprietary.
    Sequence:

    PRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCR CMSVNLSDSDKQ


    Database link: Q9H772

  • Positive control

    • Human prostate tissue.
  • General notes

     This product was previously labelled as GREM2

Properties

Applications

Our Abpromise guarantee covers the use of ab189387 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
IHC-P Use a concentration of 10 µg/ml.

Target

  • Function

    Cytokine that inhibits the activity of BMP2 and BMP4 in a dose-dependent manner. Antagonized BMP4-induced suppression of progesterone production in granulosa cells.
  • Sequence similarities

    Belongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • BMP antagonist 2 antibody
    • CKTSF1B2 antibody
    • Cysteine knot superfamily 1 antibody
    • Cysteine knot superfamily 1 BMP antagonist 2 antibody
    • DAN domain family member 3 antibody
    • DAND 3 antibody
    • DAND3 antibody
    • GREM 2 antibody
    • Grem2 antibody
    • GREM2_HUMAN antibody
    • Gremlin 2 antibody
    • Gremlin 2 cysteine knot superfamily homolog antibody
    • Gremlin-2 antibody
    • Gremlin2 antibody
    • PRDC antibody
    • Protein related to DAN and cerberus antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue sections labeling PRDC using ab189387 at 10 µg/ml.

References

ab189387 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189387.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up