Overview

  • Product name

  • Description

    Mouse monoclonal to PRDM11
  • Host species

    Mouse
  • Specificity

    ab200910 was developed against a fully folded protein domain, so it does not show good reactivity against denatured proteins, and may not work in western blot applications.
  • Tested applications

    Suitable for: MS, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PRDM11 aa 79-314. (PMG and SET domains) .
    Sequence:

    DSSAMEVEPKKLKGKRDLIVPKSFQQVDFWFCESCQEYFVDECPNHGPPV FVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGP YEGQISTQDKSAGFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREER EQNLLAFQHSERIYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRN LARGEKRLQREKSEQVLDNPEDLRGPIHLSVLRQGK


    Database link: Q9NQV5

  • Positive control

    • HEK293 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab200910 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
MS Use at an assay dependent concentration.
IP Use at an assay dependent concentration.

2 μg per IP.

Target

  • Database links

  • Alternative names

    • PFM8 antibody
    • PR domain containing 11 antibody
    • PR domain containing protein 11 antibody
    • PRDM 11 antibody

References

ab200910 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab200910.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up