Overview

  • Product name

  • Description

    Mouse monoclonal to PRDM4/PFM1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IPmore details
    Unsuitable for: WB
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PRDM4/PFM1 aa 390-540. (Catalytic domain)
    Sequence:

    EHGPVTFVPDTPIESRARLSLPKQLVLRQSIVGAEVGVWTGETIPVRTCF GPLIGQQSHSMEVAEWTDKAVNHIWKIYHNGVLEFCIITTDENECNWMMF VRKARNREEQNLVAYPHDGKIFFCTSQDIPPENELLFYYSRDYAQQIGVP E


    Database link: Q9UKN5

  • Positive control

    • HEK293 cells overexpressing flag tagged PRDM4/PFM1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab200947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.

2 mg per IP

  • Application notes
    Is unsuitable for WB.
  • Target

    • Function

      May function as a transcription factor involved in cell differentiation.
    • Tissue specificity

      Expressed in many tissues. Highly expressed in ovary, testis, pancreas, brain, heart and prostate.
    • Sequence similarities

      Contains 6 C2H2-type zinc fingers.
      Contains 1 SET domain.
    • Cellular localization

      Nucleus.
    • Information by UniProt
    • Database links

    • Alternative names

      • MGC45046 antibody
      • PFM 1 antibody
      • PFM1 antibody
      • PR domain containing 4 antibody
      • PR domain containing protein 4 antibody
      • PR domain zinc finger protein 4 antibody
      • PR domain zinc finger protein PFM 1 antibody
      • PR domain zinc finger protein PFM1 antibody
      • PR domain-containing protein 4 antibody
      • PR/SET domain 4 antibody
      • PRDM 4 antibody
      • PRDM4 antibody
      • PRDM4_HUMAN antibody
      see all

    Images

    • Immunoprecipitation analysis on HEK293 cells overexpressing flag tagged PRDM4 protein. Western blot using anti-flag antibody was performed on the raw lysate (lane 1), and samples immunoprecipitated with ab200947 (lane 2).

    References

    ab200947 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab200947.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up