Overview

  • Product name
    Anti-PRDM4/PFM1 antibody - C-terminal
    See all PRDM4/PFM1 primary antibodies
  • Description
    Rabbit polyclonal to PRDM4/PFM1 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Human, Pig, Saccharomyces cerevisiae, Drosophila melanogaster
  • Immunogen

    Synthetic peptide within Mouse PRDM4/PFM1 aa 751-800 (C terminal). The exact sequence is proprietary.
    Sequence:

    HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS


    Database link: Q80V63

  • Positive control
    • Mouse liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab170982 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa.

Target

Images

  • Anti-PRDM4/PFM1 antibody - C-terminal (ab170982) at 1 µg/ml + Mouse liver lysate at 10 µg

    Predicted band size: 88 kDa

References

ab170982 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170982.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up