Anti-prekallikrein + Kallikrein immobilized antibody [10G3-42] (ab185493)

Overview

  • Product name
    Anti-prekallikrein + Kallikrein immobilized antibody [10G3-42]
  • Description
    Mouse Monoclonal [10G3-42] to prekallikrein + Kallikrein immobilized
  • Host species
    Mouse
  • Tested applications
    Suitable for: SDS-PAGEmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length native protein (purified) aa 1-262. Purified from Hybridoma cell culture.
    Sequence:

    MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQC GGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPG FNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVG STCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCV GHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSY VKWIEDTIAENS


    Database link: P06870

  • General notes

    ab185493 is an immobilized monoclonal antibody to Human prekallikrein and kallikrein. It is extremely useful for the affinity purification of prekallikrein and kallikrein from chromatography fractions or directly from Human plasma.

    Supplied as a resin; 1/1 slurry.

Properties

Applications

Our Abpromise guarantee covers the use of ab185493 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
AP Use at an assay dependent concentration.
SDS-PAGE Use at an assay dependent concentration.

Images

  • SDS-PAGE analysis of Kallikrein 1.

    Lane 1) Partially purified Kallikrein 1 from ion-exchange resin (non-reduced)

    Lane 2) Partially purified Kallikrein 1 from ion-exchange resin (reduced)

    Lane 3) 95% purified Kallikrein 1 from immobilized resin (non-reduced)

    Lane 4) 95% purified Kallikrein 1 from immobilized resin (reduced)

References

ab185493 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185493.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up