Overview

  • Product name

  • Description

    Rabbit polyclonal to PREX1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PREX1 aa 746-876.
    Sequence:

    CAGQCILKVNGSNVMNDGAPEVLEHFQAFRSRREEALGLYQWIYHTHEDA QEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSPMVTLT VDNVHLEHGVVYEYVSTAGVRCHVLEKIVEP


    Database link: Q8TCU6

  • Positive control

    • IHC-P: Human hippopcampus, lymph node and small intestine tissues. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab223698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Functions as a RAC guanine nucleotide exchange factor (GEF), which activates the Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gamma subunits of heterotrimeric G protein. May function downstream of heterotrimeric G proteins in neutrophils.
  • Tissue specificity

    Mainly expressed in peripheral blood leukocytes and brain. Expressed at intermediate level in spleen and lymph nodes, and weakly expressed in other tissues.
  • Sequence similarities

    Contains 1 DEP domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 1 PDZ (DHR) domain.
    Contains 2 PH domains.
  • Cellular localization

    Cytoplasm > cytosol. Cell membrane. Mainly cytosolic. Some amount is apparently associated to the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 antibody
    • 5)-dependent Rac exchanger 1 antibody
    • KIAA1415 antibody
    • OTTHUMP00000031228 antibody
    • P REX1 antibody
    • P Rex1 protein like antibody
    • P-Rex1 antibody
    • Phosphatidylinositol 3,4,5 trisphosphate dependent Rac exchange factor 1 antibody
    • Phosphatidylinositol 3,4,5 trisphosphate dependent Rac exchanger 1 antibody
    • Phosphatidylinositol 3,4,5 trisphosphate dependent Rac exchanger 1 protein antibody
    • Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein antibody
    • Prex1 antibody
    • PREX1_HUMAN antibody
    • PtdIns(3 antibody
    • PtdIns(3,4,5) dependent Rac exchanger 1 antibody
    • SET domain containing 6 antibody
    • Setd6 antibody
    see all

Images

  • Paraffin-embedded human hippocampus tissue stained for PREX1 using ab223698 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lymph node tissue stained for PREX1 using ab223698 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human small intestine tissue stained for PREX1 using ab223698 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for PREX1 using ab223698 at 1/200 dilution in immunohistochemical analysis. Negative control - no staining.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for PREX1 (green) using ab223698 at 4 µg/ml in ICC/IF.

References

ab223698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up