Overview

  • Product name

    Anti-PREX2 antibody - N-terminal
    See all PREX2 primary antibodies
  • Description

    Rabbit polyclonal to PREX2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human PREX2 aa 35-84 (N terminal). The exact sequence is proprietary.
    Sequence:

    ERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETVKMLFSNIEDILAVH


    Database link: Q70Z35

  • Positive control

    • HeLa whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 183 kDa.

Target

  • Function

    Functions as a RAC1 guanine nucleotide exchange factor (GEF), activating Rac proteins by exchanging bound GDP for free GTP. Its activity is synergistically activated by phosphatidylinositol-3,4,5-triphosphate and the beta gamma subunits of heterotrimeric G protein. Mediates the activation of RAC1 in a PI3K-dependent manner. May be an important mediator of Rac signaling, acting directly downstream of both G protein-coupled receptors and phosphoinositide 3-kinase.
  • Tissue specificity

    Isoform 1 is highly expressed in skeletal muscle, heart and placenta, absent from peripheral blood leukocytes. Isoform 2 is expressed in skeletal muscle, kidney, small intestine, and placenta. Isoform 3 is expressed in the heart.
  • Sequence similarities

    Contains 2 DEP domains.
    Contains 1 DH (DBL-homology) domain.
    Contains 2 PDZ (DHR) domains.
    Contains 1 PH domain.
  • Domain

    PH domain confers substrate specificity and recognition. Able to discriminate between RAC1, RHOA, and CDC42.
    DH domain alone was unable to confer substrate specificity and recognition.
  • Information by UniProt
  • Database links

  • Alternative names

    • 4 antibody
    • 5)-dependent Rac exchanger 2 antibody
    • 5-trisphosphate-dependent Rac exchanger 2 protein antibody
    • 6230420N16Rik antibody
    • DEP domain-containing protein 2 antibody
    • DEP.2 antibody
    • DEPDC2 antibody
    • FLJ12987 antibody
    • P-Rex2 antibody
    • Phosphatidylinositol 3 antibody
    • phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 antibody
    • phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein antibody
    • phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2 antibody
    • PREX2 antibody
    • PREX2_HUMAN antibody
    • PtdIns(3 antibody
    • PtdIns(3,4,5)-dependent Rac exchanger 2 antibody
    see all

Images

  • Anti-PREX2 antibody - N-terminal (ab182482) at 1 µg/ml + HeLa whole cell lysate at 10 µg

    Predicted band size: 183 kDa

References

ab182482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182482.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up