Overview

  • Product name

  • Description

    Rabbit polyclonal to PRG-5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow
  • Immunogen

    Synthetic peptide corresponding to Human PRG-5 aa 36-84 (N terminal).
    Sequence:

    FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET


    (Peptide available as ab238792)

  • Positive control

    • Jurkat cell lysate
  • General notes

    Previously labelled as PAP2D.

Properties

Applications

Our Abpromise guarantee covers the use of ab84659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.Can be blocked with Human PRG-5 peptide (ab238792). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Images

  • Anti-PRG-5 antibody (ab84659) at 1 µg/ml (in 5% skim milk / PBS buffer) + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 35 kDa
    Observed band size: 40 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Coiro P  et al. Plasticity-related gene 5 promotes spine formation in murine hippocampal neurons. J Biol Chem 289:24956-70 (2014). WB ; Mouse . Read more (PubMed: 25074937) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up