Overview

  • Product name

    Anti-PRG-5 antibody - N-terminal
    See all PRG-5 primary antibodies
  • Description

    Rabbit polyclonal to PRG-5 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human PRG-5 aa 2-51 (N terminal). The exact sequence is proprietary. (NP_001032394).
    Sequence:

    PLLPAALTSSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYR


    Database link: Q32ZL2
    (Peptide available as ab219839)

  • Positive control

    • Human thymus tumor lysate.
  • General notes

    Previously labelled as PAP2D.

Properties

Applications

Our Abpromise guarantee covers the use of ab186445 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.

Target

Images

  • Anti-PRG-5 antibody - N-terminal (ab186445) at 1 µg/ml + Human thymus tumor lysate at 10 µg

    Predicted band size: 35 kDa

References

ab186445 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186445.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up