Anti-PRIMA1 antibody (ab220624)
Key features and details
- Rabbit polyclonal to PRIMA1
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PRIMA1 antibody
See all PRIMA1 primary antibodies -
Description
Rabbit polyclonal to PRIMA1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human PRIMA1 aa 119-153.
Sequence:KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
Database link: Q86XR5 -
Positive control
- U-2 OS cells.
-
General notes
Previously labelled as Proline-rich membrane anchor 1.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220624 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
Required to anchor acetylcholinesterase (ACHE) to the basal lamina of the neuromuscular junction and to the membrane of neuronal synapses in brain. Also able to organize ACHE into tetramers. -
Sequence similarities
Contains 1 PRAD (Pro-rich attachment) domain. -
Domain
The proline-rich attachment domain (PRAD) binds the AChE catalytic subunits. -
Cellular localization
Cell membrane. Cell junction. Cell junction > synapse. In the brain, PRIMA linked to ACHE is found in membrane rafts. - Information by UniProt
-
Database links
- Entrez Gene: 145270 Human
- Entrez Gene: 170952 Mouse
- Entrez Gene: 690195 Rat
- Omim: 613851 Human
- SwissProt: Q86XR5 Human
- SwissProt: Q810F0 Mouse
- SwissProt: D3ZZP4 Rat
- Unigene: 432401 Human
see all -
Alternative names
- PRiMA antibody
- PRIMA_HUMAN antibody
- Prima1 antibody
- Proline-rich membrane anchor 1 antibody
Images
Protocols
Datasheets and documents
References (0)
ab220624 has not yet been referenced specifically in any publications.