Anti-PRIMA1 antibody (ab220624)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PRIMA1 antibody
See all PRIMA1 primary antibodies -
Description
Rabbit polyclonal to PRIMA1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human PRIMA1 aa 119-153.
Sequence:KRKPLRKDENGTSVAEYPMSASQSNKGVDVNNAVV
Database link: Q86XR5 -
Positive control
- U-2 OS cells.
-
General notes
Previously labelled as Proline-rich membrane anchor 1.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220624 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
Target
-
Function
Required to anchor acetylcholinesterase (ACHE) to the basal lamina of the neuromuscular junction and to the membrane of neuronal synapses in brain. Also able to organize ACHE into tetramers. -
Sequence similarities
Contains 1 PRAD (Pro-rich attachment) domain. -
Domain
The proline-rich attachment domain (PRAD) binds the AChE catalytic subunits. -
Cellular localization
Cell membrane. Cell junction. Cell junction > synapse. In the brain, PRIMA linked to ACHE is found in membrane rafts. - Information by UniProt
-
Database links
- Entrez Gene: 145270 Human
- Entrez Gene: 170952 Mouse
- Entrez Gene: 690195 Rat
- Omim: 613851 Human
- SwissProt: Q86XR5 Human
- SwissProt: Q810F0 Mouse
- SwissProt: D3ZZP4 Rat
- Unigene: 432401 Human
see all -
Alternative names
- PRiMA antibody
- PRIMA_HUMAN antibody
- Prima1 antibody
- Proline-rich membrane anchor 1 antibody
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PRIMA1 antibody (ab220624)Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized U-2 OS cells labeling PRIMA1 with ab220624 at 4 µg/mL (green).
Datasheets and documents
References
ab220624 has not yet been referenced specifically in any publications.
