Overview

  • Product name

  • Description

    Rabbit polyclonal to PRKAG3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human PRKAG3 aa 174-220 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    DELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTMLEIKKAFFALV


    Database link: Q9UGI9

  • Positive control

    • Human rectal carcinoma tissue.
  • General notes

     This product was previously labelled as AMPK gamma 3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab203214 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

WB 1/100 - 1/1000. Predicted molecular weight: 54 kDa.

Target

  • Function

    AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.
  • Tissue specificity

    Skeletal muscle, with weak expression in heart and pancreas.
  • Sequence similarities

    Belongs to the 5'-AMP-activated protein kinase gamma subunit family.
    Contains 4 CBS domains.
  • Domain

    The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1.
    The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP.
  • Post-translational
    modifications

    Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5 AMP activated protein kinase subunit gamma 3 antibody
    • 5''-AMP-activated protein kinase subunit gamma-3 antibody
    • AAKG3_HUMAN antibody
    • AMPK gamma 3 chain antibody
    • AMPK gamma3 antibody
    • AMPK subunit gamma-3 antibody
    • AMPKG3 antibody
    • PRKAG3 antibody
    • Protein kinase AMP activated gamma 3 non catalytic subunit antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human rectal carcinoma tissue labeling PRKAG3 with ab203214 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203214 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203214.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up