Overview

  • Product name

  • Description

    Mouse polyclonal to PRL-1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cynomolgus monkey, Orangutan
  • Immunogen

    Full length protein corresponding to Human PRL-1 aa 1-173.
    Sequence:

    MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCE ATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCI AVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLE KYRPKMRLRFKDSNGHRNNCCIQ


    Database link: NP_003454.1

  • Positive control

    • PRL-1transfected 293T cell lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab168643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa.

Target

  • Function

    Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.
  • Tissue specificity

    Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family.
    Contains 1 tyrosine-protein phosphatase domain.
  • Developmental stage

    Expressed in fetal liver.
  • Post-translational
    modifications

    Farnesylated. Farnesylation is required for membrane targeting. Unfarnesylated forms are shifted into the nucleus.
  • Cellular localization

    Cell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm > cytoskeleton > spindle. And mitotic spindle.
  • Information by UniProt
  • Database links

  • Alternative names

    • HH 72 antibody
    • HH72 antibody
    • Hypothetical protein DKFZp779M0721 antibody
    • Phosphatase of regenerating liver 1 antibody
    • PRL 1 antibody
    • PRL-1 antibody
    • PRL1 antibody
    • Protein tyrosine phosphatase PTPCAAX1 antibody
    • Protein tyrosine phosphatase type IVA 1 antibody
    • Protein tyrosine phosphatase type IVA member 1 antibody
    • Protein-tyrosine phosphatase 4a1 antibody
    • Protein-tyrosine phosphatase of regenerating liver 1 antibody
    • Protein-tyrosine phosphatase, type 4A, 1 antibody
    • PTP(CAAXI) antibody
    • Ptp4a1 antibody
    • PTPCAAX1 antibody
    • TP4A1_HUMAN antibody
    see all

Images

  • All lanes : Anti-PRL-1 antibody (ab168643) at 1 µg/ml

    Lane 1 : PRL-1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate


    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 20 kDa

References

ab168643 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up