Overview

  • Product name

    Anti-pro Caspase-7 antibody
    See all pro Caspase-7 primary antibodies
  • Description

    Rabbit polyclonal to pro Caspase-7
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Rat pro Caspase-7 aa 1-250. (Expressed in E.coli).
    Sequence:

    MTDDQDCAAELEMADSSTEDGVDAKPDRSTIISSLLWKKKKNASMCPVST TRDRVPTYLYRMDFEKMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKC FRSLGFEVTVYNDCSCAKMQDLLRRASEEDHSNSACFACVLLSHGEENLI YGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSG PINDTDANPRYKIPVEADFLFAYSTVPGXXSWRNPGKGSWFVQALCSILN


    Database link: P55210

  • Positive control

    • IHC-P: Rat stomach tissue. WB: Recombinant rat pro Caspase 7 protein; Rat liver lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab231532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 34 kDa.

Target

  • Function

    Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-
    -Gly-217' bond. Overexpression promotes programmed cell death.
  • Tissue specificity

    Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.
  • Sequence similarities

    Belongs to the peptidase C14A family.
  • Post-translational
    modifications

    Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • apoptosis-related cysteine peptidase antibody
    • Apoptotic protease Mch-3 antibody
    • CASP-7 antibody
    • CASP7 antibody
    • CASP7_HUMAN antibody
    • Caspase-7 subunit p11 antibody
    • CMH-1 antibody
    • ICE-LAP3 antibody
    • ICE-like apoptotic protease 3 antibody
    see all

Images

  • Anti-pro Caspase-7 antibody (ab231532) at 3 µg/ml + Rat liver lysate

    Predicted band size: 34 kDa

  • Anti-pro Caspase-7 antibody (ab231532) at 2 µg/ml + Recombinant rat pro Caspase 7 protein

    Predicted band size: 34 kDa

  • Paraffin-embedded rat stomach tissue stained for pro caspase 7 using ab231532 at 20 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat stomach tissue stained for pro caspase 7 using ab231532 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up